PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g11118.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 361aa    MW: 41557.1 Da    PI: 9.4502
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g11118.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.11.3e-0812534990
              FAR1 49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                       + +r ra++++gCka++ vk++ dg  +++ ++ eHnH+l+
  Bradi4g11118.1.p 12 GELQRGRASKKIGCKAHMGVKMNADGGCVIKGIHFEHNHQLT 53
                      5668899*********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-51253IPR004330FAR1 DNA binding domain
PfamPF105511.2E-27164256IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MKGKYTTSVH DGELQRGRAS KKIGCKAHMG VKMNADGGCV IKGIHFEHNH QLTLSPSMLV  60
FLHSHKRVNP TLQDYIKDLQ LSNVKHVNIM SLLTRLSGGR DKLGCHNRDV LNMKAKNARK  120
ESADDVQKLF KFFDDMTEEN ENFYYDVHAN ASCRAAYADF GDCTTFDTTY KSNKFHLPLA  180
VFVGVSNHLL SSIFGVALMG DESVYSFKWV FSTFLKCMRG KQPICMLTDQ CPSMAKAIPQ  240
IFPRSLHKLC RWHIMRKHKD SLGKLYKLFP DLKDQLAAVL NHPLMPTEFE AAWHELVNKY  300
NLHDVNIMVN FWNERKTWVS AYWKDVFCAC MTSTQRSESM NHVLKKRFVR EQHDLHIFTQ  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLI1IWB01e-156I1IWB0_BRADI; Uncharacterized protein
STRINGBRADI5G03570.11e-155(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-62FAR1-related sequence 5